SCOPe 2.08: Domain d6wnua2: 6wnu A:434-523

Lineage for d6wnua2 (6wnu A:434-523)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Caldanaerobacter subterraneus [TaxId:911092] [404129] (1 PDB entry)

8. Domain d6wnua2: 6wnu A:434-523 [404130]
   Other proteins in same PDB: d6wnua1
   automated match to d1qhoa3
   complexed with act, ca, peg

Details for d6wnua2

PDB Entry: 6wnu, 1.88 Å

PDB Description: crystal structure of the three-domain cyclomaltodextrin glucanotransferase clda in the monomeric form

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d6wnua2:

Sequence; same for both SEQRES and ATOM records:

>d6wnua2 b.71.1.0 (A:434-523) automated matches {Caldanaerobacter subterraneus [TaxId: 911092]}
gtttaryvsddvyiyerqygkdvvlvainkgekttvktvktslrkgiykdylkgllkgve
lkvtkgngenlvqdltlpgnsvsvwtnvrv

Timeline for d6wnua2:

• d6wnua2 first appeared in SCOPe 2.07