Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Caldanaerobacter subterraneus [TaxId:911092] [404129] (1 PDB entry) |
Domain d6wnua2: 6wnu A:434-523 [404130] Other proteins in same PDB: d6wnua1 automated match to d1qhoa3 complexed with act, ca, peg |
PDB Entry: 6wnu (more details), 1.88 Å
SCOPe Domain Sequences for d6wnua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wnua2 b.71.1.0 (A:434-523) automated matches {Caldanaerobacter subterraneus [TaxId: 911092]} gtttaryvsddvyiyerqygkdvvlvainkgekttvktvktslrkgiykdylkgllkgve lkvtkgngenlvqdltlpgnsvsvwtnvrv
Timeline for d6wnua2: