Lineage for d1lkla_ (1lkl A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82452Fold d.93: SH2-like [55549] (1 superfamily)
  4. 82453Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 82454Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 82532Protein p56-lck tyrosine kinase [55552] (1 species)
  7. 82533Species Human (Homo sapiens) [TaxId:9606] [55553] (9 PDB entries)
  8. 82535Domain d1lkla_: 1lkl A: [40413]

Details for d1lkla_

PDB Entry: 1lkl (more details), 1.8 Å

PDB Description: human p56-lck tyrosine kinase sh2 domain in complex with the phosphotyrosyl peptide ac-ptyr-glu-glu-gly (pyeeg peptide)

SCOP Domain Sequences for d1lkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lkla_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens)}
epepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhyk
irnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOP Domain Coordinates for d1lkla_:

Click to download the PDB-style file with coordinates for d1lkla_.
(The format of our PDB-style files is described here.)

Timeline for d1lkla_: