Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (20 proteins) |
Protein p56-lck tyrosine kinase [55552] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55553] (9 PDB entries) |
Domain d1lkka_: 1lkk A: [40412] |
PDB Entry: 1lkk (more details), 1 Å
SCOP Domain Sequences for d1lkka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens)} lepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkhy kirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
Timeline for d1lkka_: