Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
Protein Bacterial chitobiase, Domain 2 [55547] (1 species) |
Species Serratia marcescens [TaxId:615] [55548] (4 PDB entries) |
Domain d1c7ta4: 1c7t A:201-337 [40411] Other proteins in same PDB: d1c7ta1, d1c7ta2, d1c7ta3 complexed with so4; mutant |
PDB Entry: 1c7t (more details), 1.9 Å
SCOPe Domain Sequences for d1c7ta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ta4 d.92.2.1 (A:201-337) Bacterial chitobiase, Domain 2 {Serratia marcescens [TaxId: 615]} snadlqtlpagalrgkivptpmqvkvhaqdadlrkgvaldlstlvkpaadvvsqrfallg vpvqtngypiktdiqpgkfkgamavsgayelkigkkeaqvigfdqagvfyglqsilslvp sdgsgkiatldasdapr
Timeline for d1c7ta4: