SCOPe 2.07: Domain d6wk4b2: 6wk4 B:107-212

Lineage for d6wk4b2 (6wk4 B:107-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d6wk4b2: 6wk4 B:107-212 [404088]
   Other proteins in same PDB: d6wk4b1
   automated match to d1dn0a2
   complexed with trs

Details for d6wk4b2

PDB Entry: 6wk4, 2.1 Å

PDB Description: fab fragment of anti-human lag3 antibody (13e2)

PDB Compounds: (B:) 13E2 Fab Light Chain

SCOPe Domain Sequences for d6wk4b2:

Sequence; same for both SEQRES and ATOM records:

>d6wk4b2 b.1.1.2 (B:107-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakyqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d6wk4b2:

• d6wk4b2 is new in SCOPe 2.07-stable
  
• d6wk4b2 appears in the current release, SCOPe 2.08