Lineage for d1buvm_ (1buv M:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529558Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2529835Protein Membrane-type matrix metalloproteinase (CDMT1-MMP) [55543] (1 species)
  7. 2529836Species Human (Homo sapiens) [TaxId:9606] [55544] (2 PDB entries)
  8. 2529837Domain d1buvm_: 1buv M: [40407]
    Other proteins in same PDB: d1buvt_
    complexed with ca, zn

Details for d1buvm_

PDB Entry: 1buv (more details), 2.75 Å

PDB Description: crystal structure of the mt1-mmp-timp-2 complex
PDB Compounds: (M:) protein (membrane-type matrix metalloproteinase (cdmt1-mmp))

SCOPe Domain Sequences for d1buvm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buvm_ d.92.1.11 (M:) Membrane-type matrix metalloproteinase (CDMT1-MMP) {Human (Homo sapiens) [TaxId: 9606]}
iqglkwqhneitfciqnytpkvgeyatyeairkafrvwesatplrfrevpyayireghek
qadimiffaegfhgdstpfdgeggflahayfpgpniggdthfdsaepwtvrnedlngndi
flvavhelghalglehssdpsaimapfyqwmdtenfvlpdddrrgiqqlygges

SCOPe Domain Coordinates for d1buvm_:

Click to download the PDB-style file with coordinates for d1buvm_.
(The format of our PDB-style files is described here.)

Timeline for d1buvm_: