SCOPe 2.08: Domain d3usna_: 3usn A:

Lineage for d3usna_ (3usn A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)

8. Domain d3usna_: 3usn A: [40394]
   complexed with att, ca, zn

Details for d3usna_

PDB Entry: 3usn

PDB Description: structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the thiadiazole inhibitor ipnu-107859, nmr, 1 structure

PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d3usna_:

Sequence; same for both SEQRES and ATOM records:

>d3usna_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

Timeline for d3usna_:

• d3usna_ first appeared (with stable ids) in SCOP 1.55, called d3usn__
  
• d3usna_ appears in SCOPe 2.07