SCOPe 2.07: Domain d6t8xf_: 6t8x F:

Lineage for d6t8xf_ (6t8x F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
   CaMK group; MAPKAPK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [82790] (16 PDB entries)

8. Domain d6t8xf_: 6t8x F: [403909]
   automated match to d3kc3c_
   complexed with b97, cl, mw8

Details for d6t8xf_

PDB Entry: 6t8x, 2.81 Å

PDB Description: crystal structure of mapkapk2 (mk2) complexed with pf-3644022 and 5- (4-bromophenyl)-n-[4-(1-piperazinyl)phenyl]-n-(2-pyridinylmethyl)-2- furancarboxamide

PDB Compounds: (F:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d6t8xf_:

Sequence, based on SEQRES records:

>d6t8xf_ d.144.1.7 (F:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
qfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarre
velhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereas
eimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnsltepc
ytpyyvapevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqy
efpnpewsevseevkmlirnllkteptqrmtitefmnhpwimqst

Sequence, based on observed residues (ATOM records):

>d6t8xf_ d.144.1.7 (F:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
qfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarre
velhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereas
eimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettytpyyvape
vlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewse
vseevkmlirnllkteptqrmtitefmnhpwimqst

Timeline for d6t8xf_:

• d6t8xf_ is new in SCOPe 2.07-stable
  
• d6t8xf_ appears in the current release, SCOPe 2.08