| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) ![]() Pfam PF06596 |
| Family f.23.40.1: PsbX-like [267615] (2 proteins) |
| Protein automated matches [267680] (2 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [311275] (12 PDB entries) |
| Domain d7nhqx_: 7nhq X: [403857] Other proteins in same PDB: d7nhqa_, d7nhqb_, d7nhqc_, d7nhqd_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhql_, d7nhqm_, d7nhqt_, d7nhqz_ automated match to d5v2cx_ complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhq (more details), 2.68 Å
SCOPe Domain Sequences for d7nhqx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhqx_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidk
Timeline for d7nhqx_: