SCOPe 2.07: Domain d6rlmp2: 6rlm P:123-229

Lineage for d6rlmp2 (6rlm P:123-229)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d6rlmp2: 6rlm P:123-229 [403846]
Other proteins in same PDB: d6rlmb1, d6rlmd1, d6rlmf1, d6rlmh1, d6rlmj1, d6rlml1, d6rlmn1, d6rlmp1
automated match to d1dn0a2
complexed with cl

Details for d6rlmp2

PDB Entry: 6rlm (more details), 2.5 Å

PDB Description: crystal structure of at1412dm fab fragment

PDB Compounds: (P:) AT1412dm Fab (Light Chain)

SCOPe Domain Sequences for d6rlmp2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rlmp2 b.1.1.2 (P:123-229) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtaaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6rlmp2:

Click to download the PDB-style file with coordinates for d6rlmp2.
(The format of our PDB-style files is described here.)

Timeline for d6rlmp2: