Lineage for d5qu7b1 (5qu7 B:5-60)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392869Protein automated matches [190043] (8 species)
    not a true protein
  7. 2392904Species Human (Homo sapiens) [TaxId:9606] [187799] (39 PDB entries)
  8. 2392915Domain d5qu7b1: 5qu7 B:5-60 [403831]
    Other proteins in same PDB: d5qu7a2, d5qu7b2
    automated match to d2b86a_

Details for d5qu7b1

PDB Entry: 5qu7 (more details), 1.27 Å

PDB Description: crystal structure of swapped human nck sh3.1 domain, 1.3a, orthorhombic form iii
PDB Compounds: (B:) cytoplasmic protein nck1

SCOPe Domain Sequences for d5qu7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qu7b1 b.34.2.1 (B:5-60) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvvvakfdyvaqqeqeldikknerlwllddskswwrvrnsmnktgfvpsnyverk

SCOPe Domain Coordinates for d5qu7b1:

Click to download the PDB-style file with coordinates for d5qu7b1.
(The format of our PDB-style files is described here.)

Timeline for d5qu7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5qu7b2