Lineage for d7nhqd_ (7nhq D:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632796Protein Photosystem II reaction center d2 protein PsbD2 [161051] (2 species)
  7. 2632797Species Thermosynechococcus elongatus [TaxId:146786] [161052] (5 PDB entries)
    Uniprot Q8CM25 13-352
  8. 2632800Domain d7nhqd_: 7nhq D: [403815]
    Other proteins in same PDB: d7nhqa_, d7nhqb_, d7nhqc_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhql_, d7nhqm_, d7nhqt_, d7nhqx_, d7nhqz_
    automated match to d2axtd1
    complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhqd_

PDB Entry: 7nhq (more details), 2.68 Å

PDB Description: structure of psii-i prime (psii with psb28, and psb34)
PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d7nhqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhqd_ f.26.1.1 (D:) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqphenfvfpeevlprgnal

SCOPe Domain Coordinates for d7nhqd_:

Click to download the PDB-style file with coordinates for d7nhqd_.
(The format of our PDB-style files is described here.)

Timeline for d7nhqd_: