| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein Photosystem II reaction center d2 protein PsbD2 [161051] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161052] (5 PDB entries) Uniprot Q8CM25 13-352 |
| Domain d7nhqd_: 7nhq D: [403815] Other proteins in same PDB: d7nhqa_, d7nhqb_, d7nhqc_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhql_, d7nhqm_, d7nhqt_, d7nhqx_, d7nhqz_ automated match to d2axtd1 complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhq (more details), 2.68 Å
SCOPe Domain Sequences for d7nhqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhqd_ f.26.1.1 (D:) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d7nhqd_: