| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) ![]() automatically mapped to Pfam PF02532 |
| Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
| Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161044] (7 PDB entries) Uniprot Q8DJZ6 1-35 |
| Domain d7nhoi_: 7nho I: [403797] Other proteins in same PDB: d7nhoa_, d7nhob_, d7nhoc_, d7nhod_, d7nhoe_, d7nhof_, d7nhoh_, d7nhok_, d7nhol_, d7nhom_, d7nhot_, d7nhox_, d7nhoz_ automated match to d2axti1 complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nho (more details), 2.66 Å
SCOPe Domain Sequences for d7nhoi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhoi_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]}
metlkitvyivvtffvllfvfgflsgdparnpkrk
Timeline for d7nhoi_: