SCOPe 2.08: Domain d7nhoi_: 7nho I:

Lineage for d7nhoi_ (7nho I:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family)
   automatically mapped to Pfam PF02532

5. Family f.23.37.1: PsbI-like [161042] (1 protein)
   Pfam PF02532

6. Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161044] (7 PDB entries)
   Uniprot Q8DJZ6 1-35

8. Domain d7nhoi_: 7nho I: [403797]
   Other proteins in same PDB: d7nhoa_, d7nhob_, d7nhoc_, d7nhod_, d7nhoe_, d7nhof_, d7nhoh_, d7nhok_, d7nhol_, d7nhom_, d7nhot_, d7nhox_, d7nhoz_
   automated match to d2axti1
   complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhoi_

PDB Entry: 7nho, 2.66 Å

PDB Description: structure of psii-m

PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d7nhoi_:

Sequence; same for both SEQRES and ATOM records:

>d7nhoi_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 146786]}
metlkitvyivvtffvllfvfgflsgdparnpkrk

Timeline for d7nhoi_:

• d7nhoi_ first appeared in SCOPe 2.07