SCOPe 2.08: Domain d7nxkd2: 7nxk D:158-261

Lineage for d7nxkd2 (7nxk D:158-261)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225840] (19 PDB entries)

8. Domain d7nxkd2: 7nxk D:158-261 [403789]
   Other proteins in same PDB: d7nxka_, d7nxkc_
   automated match to d2i53a2
   complexed with uub

Details for d7nxkd2

PDB Entry: 7nxk, 3 Å

PDB Description: crystal structure of human cdk12/cyclin k in complex with the inhibitor bsj-01-175

PDB Compounds: (D:) cyclin-k

SCOPe Domain Sequences for d7nxkd2:

Sequence; same for both SEQRES and ATOM records:

>d7nxkd2 a.74.1.1 (D:158-261) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqg

Timeline for d7nxkd2:

• d7nxkd2 first appeared in SCOPe 2.07