| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) ![]() automatically mapped to Pfam PF00737 |
| Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
| Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161028] (8 PDB entries) Uniprot Q8DJ43 2-65 |
| Domain d7nhph_: 7nhp H: [403784] Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_ automated match to d2axth1 complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhp (more details), 2.72 Å
SCOPe Domain Sequences for d7nhph_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhph_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg
Timeline for d7nhph_: