Lineage for d7nhph_ (7nhp H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631822Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 2631823Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2631824Protein Photosystem II reaction center protein H, PsbH [161027] (2 species)
  7. 2631825Species Thermosynechococcus elongatus [TaxId:146786] [161028] (8 PDB entries)
    Uniprot Q8DJ43 2-65
  8. 2631831Domain d7nhph_: 7nhp H: [403784]
    Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_
    automated match to d2axth1
    complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhph_

PDB Entry: 7nhp (more details), 2.72 Å

PDB Description: structure of psii-i (psii with psb27, psb28, and psb34)
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d7nhph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhph_ f.23.33.1 (H:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

SCOPe Domain Coordinates for d7nhph_:

Click to download the PDB-style file with coordinates for d7nhph_.
(The format of our PDB-style files is described here.)

Timeline for d7nhph_: