| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein Photosystem II reaction center d2 protein PsbD2 [161051] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161052] (5 PDB entries) Uniprot Q8CM25 13-352 |
| Domain d7nhod_: 7nho D: [403773] Other proteins in same PDB: d7nhoa_, d7nhob_, d7nhoc_, d7nhoe_, d7nhof_, d7nhoh_, d7nhoi_, d7nhok_, d7nhol_, d7nhom_, d7nhot_, d7nhox_, d7nhoz_ automated match to d2axtd1 complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nho (more details), 2.66 Å
SCOPe Domain Sequences for d7nhod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhod_ f.26.1.1 (D:) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]}
gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn
fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei
arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt
lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf
wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe
tfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d7nhod_: