SCOPe 2.08: Domain d7nhod_: 7nho D:

Lineage for d7nhod_ (7nho D:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein Photosystem II reaction center d2 protein PsbD2 [161051] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161052] (5 PDB entries)
   Uniprot Q8CM25 13-352

8. Domain d7nhod_: 7nho D: [403773]
   Other proteins in same PDB: d7nhoa_, d7nhob_, d7nhoc_, d7nhoe_, d7nhof_, d7nhoh_, d7nhoi_, d7nhok_, d7nhol_, d7nhom_, d7nhot_, d7nhox_, d7nhoz_
   automated match to d2axtd1
   complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhod_

PDB Entry: 7nho, 2.66 Å

PDB Description: structure of psii-m

PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d7nhod_:

Sequence; same for both SEQRES and ATOM records:

>d7nhod_ f.26.1.1 (D:) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]}
gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn
fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei
arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt
lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf
wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe
tfytknlllnegirawmapqdqphenfvfpeevlprgnal

Timeline for d7nhod_:

• d7nhod_ first appeared in SCOPe 2.07