Lineage for d7nhqz_ (7nhq Z:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629660Superfamily f.17.5: PsbZ-like [161055] (2 families) (S)
    automatically mapped to Pfam PF01737
  5. 2629661Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 2629662Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 2629673Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries)
  8. 2629691Domain d7nhqz_: 7nhq Z: [403771]
    Other proteins in same PDB: d7nhqa_, d7nhqb_, d7nhqc_, d7nhqd_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhql_, d7nhqm_, d7nhqt_, d7nhqx_
    automated match to d3a0hz_
    complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhqz_

PDB Entry: 7nhq (more details), 2.68 Å

PDB Description: structure of psii-i prime (psii with psb28, and psb34)
PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d7nhqz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhqz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
tilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnffv

SCOPe Domain Coordinates for d7nhqz_:

Click to download the PDB-style file with coordinates for d7nhqz_.
(The format of our PDB-style files is described here.)

Timeline for d7nhqz_: