Lineage for d7nhpx_ (7nhp X:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632179Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2632180Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2632184Protein automated matches [267680] (2 species)
    not a true protein
  7. 2632185Species Thermosynechococcus elongatus [TaxId:197221] [311275] (12 PDB entries)
  8. 2632193Domain d7nhpx_: 7nhp X: [403768]
    Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpz_
    automated match to d5v2cx_
    complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhpx_

PDB Entry: 7nhp (more details), 2.72 Å

PDB Description: structure of psii-i (psii with psb27, psb28, and psb34)
PDB Compounds: (X:) Photosystem II reaction center X protein

SCOPe Domain Sequences for d7nhpx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhpx_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidk

SCOPe Domain Coordinates for d7nhpx_:

Click to download the PDB-style file with coordinates for d7nhpx_.
(The format of our PDB-style files is described here.)

Timeline for d7nhpx_: