![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) ![]() |
![]() | Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (7 proteins) |
![]() | Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
![]() | Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (24 PDB entries) |
![]() | Domain d2usn__: 2usn - [40376] |
PDB Entry: 2usn (more details), 2.2 Å
SCOP Domain Sequences for d2usn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2usn__ d.92.1.11 (-) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast} frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe ighslglfhsantealmyplyhsltdltrfrlsqddingiqslyg
Timeline for d2usn__: