SCOPe 2.07: Domain d7o0ka_: 7o0k A:

Lineage for d7o0ka_ (7o0k A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (7 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [403758] (2 PDB entries)

8. Domain d7o0ka_: 7o0k A: [403759]
   automated match to d1vyfa_
   complexed with chd

Details for d7o0ka_

PDB Entry: 7o0k, 1.83 Å

PDB Description: crystal structure of recombinant chichen liver bile acid binding protein (cl-babp) in complex with cholic acid

PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d7o0ka_:

Sequence; same for both SEQRES and ATOM records:

>d7o0ka_ b.60.1.2 (A:) automated matches {Gallus gallus [TaxId: 9031]}
afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
rskrv

Timeline for d7o0ka_:

• d7o0ka_ is new in SCOPe 2.07-stable
  
• d7o0ka_ appears in the current release, SCOPe 2.08