SCOPe 2.08: Domain d7nhof_: 7nho F:

Lineage for d7nhof_ (7nho F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161050] (5 PDB entries)
   Uniprot Q8DIN9 11-45

8. Domain d7nhof_: 7nho F: [403753]
   Other proteins in same PDB: d7nhoa_, d7nhob_, d7nhoc_, d7nhod_, d7nhoe_, d7nhoh_, d7nhoi_, d7nhok_, d7nhol_, d7nhom_, d7nhot_, d7nhox_, d7nhoz_
   automated match to d2axtf1
   complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhof_

PDB Entry: 7nho, 2.66 Å

PDB Description: structure of psii-m

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d7nhof_:

Sequence; same for both SEQRES and ATOM records:

>d7nhof_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus elongatus [TaxId: 146786]}
qepvsypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d7nhof_:

• d7nhof_ first appeared in SCOPe 2.07