Lineage for d7nhqb_ (7nhq B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2634050Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 2634051Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 2634052Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 2634053Protein Photosystem II core light harvesting protein PsbB [161079] (2 species)
  7. 2634054Species Thermosynechococcus elongatus [TaxId:146786] [161080] (7 PDB entries)
    Uniprot Q8DIQ1 2-489
  8. 2634057Domain d7nhqb_: 7nhq B: [403750]
    Other proteins in same PDB: d7nhqa_, d7nhqc_, d7nhqd_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhql_, d7nhqm_, d7nhqt_, d7nhqx_, d7nhqz_
    automated match to d2axtb1
    complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhqb_

PDB Entry: 7nhq (more details), 2.68 Å

PDB Description: structure of psii-i prime (psii with psb28, and psb34)
PDB Compounds: (B:) Photosystem II CP47 reaction center protein

SCOPe Domain Sequences for d7nhqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhqb_ f.55.1.1 (B:) Photosystem II core light harvesting protein PsbB {Thermosynechococcus elongatus [TaxId: 146786]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspeqvewgfyq

SCOPe Domain Coordinates for d7nhqb_:

Click to download the PDB-style file with coordinates for d7nhqb_.
(The format of our PDB-style files is described here.)

Timeline for d7nhqb_: