Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein automated matches [191285] (5 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (35 PDB entries) |
Domain d7nhpc_: 7nhp C: [403749] Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_ automated match to d5b66c_ complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhp (more details), 2.72 Å
SCOPe Domain Sequences for d7nhpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhpc_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} rdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqg liliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyss ffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptld prvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafi wsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklg anvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiq pwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwha graraaaagfek
Timeline for d7nhpc_: