| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) ![]() automatically mapped to Pfam PF01405 |
| Family f.23.34.1: PsbT-like [161030] (2 proteins) Pfam PF01405 |
| Protein Photosystem II reaction center protein T, PsbT [161031] (3 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161032] (11 PDB entries) Uniprot Q8DIQ0 1-30 |
| Domain d7nhot_: 7nho T: [403748] Other proteins in same PDB: d7nhoa_, d7nhob_, d7nhoc_, d7nhod_, d7nhoe_, d7nhof_, d7nhoh_, d7nhoi_, d7nhok_, d7nhol_, d7nhom_, d7nhox_, d7nhoz_ automated match to d2axtt1 complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nho (more details), 2.66 Å
SCOPe Domain Sequences for d7nhot_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhot_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 146786]}
metityvfifaciialfffaiffrepprit
Timeline for d7nhot_: