Lineage for d7nhot_ (7nho T:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631879Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 2631880Family f.23.34.1: PsbT-like [161030] (2 proteins)
    Pfam PF01405
  6. 2631881Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 2631882Species Thermosynechococcus elongatus [TaxId:146786] [161032] (11 PDB entries)
    Uniprot Q8DIQ0 1-30
  8. 2631885Domain d7nhot_: 7nho T: [403748]
    Other proteins in same PDB: d7nhoa_, d7nhob_, d7nhoc_, d7nhod_, d7nhoe_, d7nhof_, d7nhoh_, d7nhoi_, d7nhok_, d7nhol_, d7nhom_, d7nhox_, d7nhoz_
    automated match to d2axtt1
    complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhot_

PDB Entry: 7nho (more details), 2.66 Å

PDB Description: structure of psii-m
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d7nhot_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhot_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 146786]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d7nhot_:

Click to download the PDB-style file with coordinates for d7nhot_.
(The format of our PDB-style files is described here.)

Timeline for d7nhot_: