SCOPe 2.08: Domain d7nhoc_: 7nho C:

Lineage for d7nhoc_ (7nho C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
   6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops

4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family)
   automatically mapped to Pfam PF00421

5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
   Pfam PF00421

6. Protein automated matches [191285] (5 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries)

8. Domain d7nhoc_: 7nho C: [403746]
   Other proteins in same PDB: d7nhoa_, d7nhob_, d7nhod_, d7nhoe_, d7nhof_, d7nhoh_, d7nhoi_, d7nhok_, d7nhol_, d7nhom_, d7nhot_, d7nhox_, d7nhoz_
   automated match to d5b66c_
   complexed with bcr, bct, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhoc_

PDB Entry: 7nho, 2.66 Å

PDB Description: structure of psii-m

PDB Compounds: (C:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d7nhoc_:

Sequence; same for both SEQRES and ATOM records:

>d7nhoc_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqg
liliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyss
ffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptld
prvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafi
wsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklg
anvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiq
pwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwha
graraaaagfekgidresepvlsmpsld

Timeline for d7nhoc_:

• d7nhoc_ first appeared in SCOPe 2.07