SCOPe 2.08: Domain d7me0d2: 7me0 D:191-345

Lineage for d7me0d2 (7me0 D:191-345)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.0: automated matches [356574] (1 protein)
   not a true family

6. Protein automated matches [356575] (3 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382219] (7 PDB entries)

8. Domain d7me0d2: 7me0 D:191-345 [403740]
   Other proteins in same PDB: d7me0a1, d7me0a3, d7me0b1, d7me0b3, d7me0c1, d7me0c3, d7me0d1, d7me0d3, d7me0e1, d7me0e3, d7me0f1, d7me0f3
   automated match to d2h85a2

Details for d7me0d2

PDB Entry: 7me0, 2.48 Å

PDB Description: cryo-em structure of sars-cov-2 nsp15 nendou at ph 6.0

PDB Compounds: (D:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d7me0d2:

Sequence; same for both SEQRES and ATOM records:

>d7me0d2 d.294.1.0 (D:191-345) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl
liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsvvskvvkvtidyteisfmlwckdghvetfypkl

Timeline for d7me0d2:

• d7me0d2 first appeared in SCOPe 2.07