| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein automated matches [190224] (14 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries) |
| Domain d7nhpa_: 7nhp A: [403738] Other proteins in same PDB: d7nhpb_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_ automated match to d2axta1 complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhp (more details), 2.72 Å
SCOPe Domain Sequences for d7nhpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhpa_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg
sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr
qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae
hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv
aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
kgnvintwadiinranlgmevmhernahnfpldla
Timeline for d7nhpa_: