Lineage for d7nhpa_ (7nhp A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632815Protein automated matches [190224] (14 species)
    not a true protein
  7. 2632924Species Thermosynechococcus elongatus [TaxId:197221] [260543] (10 PDB entries)
  8. 2632934Domain d7nhpa_: 7nhp A: [403738]
    Other proteins in same PDB: d7nhpb_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_
    automated match to d2axta1
    complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhpa_

PDB Entry: 7nhp (more details), 2.72 Å

PDB Description: structure of psii-i (psii with psb27, psb28, and psb34)
PDB Compounds: (A:) Photosystem II protein D1 1

SCOPe Domain Sequences for d7nhpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhpa_ f.26.1.1 (A:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
sanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepvsg
sllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascymgr
qwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfqae
hnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfgqeeetyniv
aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
kgnvintwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d7nhpa_:

Click to download the PDB-style file with coordinates for d7nhpa_.
(The format of our PDB-style files is described here.)

Timeline for d7nhpa_: