SCOPe 2.08: Domain d6m0tc1: 6m0t C:80-228

Lineage for d6m0tc1 (6m0t C:80-228)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [234564] (7 PDB entries)

8. Domain d6m0tc1: 6m0t C:80-228 [403723]
   Other proteins in same PDB: d6m0ta2, d6m0tb2, d6m0tc2, d6m0td2
   automated match to d3bjua1
   protein/RNA complex; complexed with ez3, lys

Details for d6m0tc1

PDB Entry: 6m0t, 2.68 Å

PDB Description: crystal structure of lysyl-trna synthetase from plasmodium falciparum complexed with l-lysine and cladosporin derivative (cl-2)

PDB Compounds: (C:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6m0tc1:

Sequence, based on SEQRES records:

>d6m0tc1 b.40.4.0 (C:80-228) automated matches {Plasmodium falciparum [TaxId: 36329]}
prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
kkgelsifpketillsaclhmlpmkyglk

Sequence, based on observed residues (ATOM records):

>d6m0tc1 b.40.4.0 (C:80-228) automated matches {Plasmodium falciparum [TaxId: 36329]}
prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
mrvssgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgksk
kgelsifpketillsaclhmlpmkyglk

Timeline for d6m0tc1:

• d6m0tc1 first appeared in SCOPe 2.07