| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) ![]() automatically mapped to Pfam PF02419 |
| Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
| Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries) |
| Domain d7nhpl_: 7nhp L: [403712] Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_ automated match to d3a0hl_ complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhp (more details), 2.72 Å
SCOPe Domain Sequences for d7nhpl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhpl_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d7nhpl_: