Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d7m7wb2: 7m7w B:115-217 [403710] Other proteins in same PDB: d7m7wb1, d7m7wd1, d7m7wf1, d7m7wl1, d7m7wr_, d7m7ws_ automated match to d1aqkl2 complexed with nag |
PDB Entry: 7m7w (more details), 2.65 Å
SCOPe Domain Sequences for d7m7wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7m7wb2 b.1.1.2 (B:115-217) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvapte
Timeline for d7m7wb2: