SCOPe 2.07: Domain d7m7wd1: 7m7w D:2-113

Lineage for d7m7wd1 (7m7w D:2-113)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d7m7wd1: 7m7w D:2-113 [403696]
   Other proteins in same PDB: d7m7wb1, d7m7wb2, d7m7wd2, d7m7wf2, d7m7wl1, d7m7wl2, d7m7wr_, d7m7ws_
   automated match to d2mcg11
   complexed with nag

Details for d7m7wd1

PDB Entry: 7m7w, 2.65 Å

PDB Description: antibodies to the sars-cov-2 receptor-binding domain that maximize breadth and resistance to viral escape

PDB Compounds: (D:) Monoclonal antibody S2H97 Fab light chain

SCOPe Domain Sequences for d7m7wd1:

Sequence; same for both SEQRES and ATOM records:

>d7m7wd1 b.1.1.0 (D:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqpasvsgspgqsitisctgissdvggynsvswyqqhpgkapklmiydvtnrpsgvs
nrfsgsksgntasltisglqaedeadyycssytssstppyvfgtgtkvsvlg

Timeline for d7m7wd1:

• d7m7wd1 is new in SCOPe 2.07-stable
  
• d7m7wd1 appears in the current release, SCOPe 2.08