Class a: All alpha proteins [46456] (289 folds) |
Fold a.127: L-aspartase-like [48556] (1 superfamily) multihelical, consists of three all-alpha domains |
Superfamily a.127.1: L-aspartase-like [48557] (3 families) |
Family a.127.1.1: L-aspartase/fumarase [48558] (6 proteins) |
Protein automated matches [190147] (10 species) not a true protein |
Species Elizabethkingia anophelis [TaxId:1338011] [403689] (1 PDB entry) |
Domain d7miwc1: 7miw C:1-463 [403692] Other proteins in same PDB: d7miwa2, d7miwb2, d7miwc2, d7miwd2 automated match to d3e04a_ complexed with edo |
PDB Entry: 7miw (more details), 1.25 Å
SCOPe Domain Sequences for d7miwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7miwc1 a.127.1.1 (C:1-463) automated matches {Elizabethkingia anophelis [TaxId: 1338011]} miyrtehdtmgevkvpvdkfwgaqtersrnnfkigpeasmpheiieafaylkkaaayant dlrvlpsdkrdmisqvcdeilegklfdqfplviwqtgsgtqsnmninevisnkahvnngg qlgeksevhpnddvnksqssndtyptamhiaaykkvvehtipavetlkntlkakseafkn ivkigrthlmdatpltlgqefsgyvaqlefglkalkntlphlaelalggtavgtglntpq gydvkvaeyiakftglpfitaenkfealaahdaiveshgalkqlavslfkiaqdirmlas gprsgigeihipenepgssimpgkvnptqneamtmvcaqvlgndttisfagtqgnyelnv fkpvmaynflqsaqliadacisfndhcavgiepneprikelvdkslmlvtalnthigyen aakiaktahkngttlkeeainlglvtaeqfdewvkpedmvgsl
Timeline for d7miwc1: