Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075) |
Superfamily d.294.1: EndoU-like [142877] (3 families) similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
Family d.294.1.0: automated matches [356574] (1 protein) not a true family |
Protein automated matches [356575] (3 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382219] (6 PDB entries) |
Domain d7me0b2: 7me0 B:191-345 [403681] Other proteins in same PDB: d7me0a1, d7me0a3, d7me0b1, d7me0b3, d7me0c1, d7me0c3, d7me0d1, d7me0d3, d7me0e1, d7me0e3, d7me0f1, d7me0f3 automated match to d2h85a2 |
PDB Entry: 7me0 (more details), 2.48 Å
SCOPe Domain Sequences for d7me0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7me0b2 d.294.1.0 (B:191-345) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd lsvvskvvkvtidyteisfmlwckdghvetfypkl
Timeline for d7me0b2: