Lineage for d7me0b2 (7me0 B:191-345)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615811Fold d.294: EndoU-like [142876] (1 superfamily)
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)
  4. 2615812Superfamily d.294.1: EndoU-like [142877] (3 families) (S)
    similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)
  5. 2615898Family d.294.1.0: automated matches [356574] (1 protein)
    not a true family
  6. 2615899Protein automated matches [356575] (3 species)
    not a true protein
  7. 2615906Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382219] (6 PDB entries)
  8. 2615917Domain d7me0b2: 7me0 B:191-345 [403681]
    Other proteins in same PDB: d7me0a1, d7me0a3, d7me0b1, d7me0b3, d7me0c1, d7me0c3, d7me0d1, d7me0d3, d7me0e1, d7me0e3, d7me0f1, d7me0f3
    automated match to d2h85a2

Details for d7me0b2

PDB Entry: 7me0 (more details), 2.48 Å

PDB Description: cryo-em structure of sars-cov-2 nsp15 nendou at ph 6.0
PDB Compounds: (B:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d7me0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7me0b2 d.294.1.0 (B:191-345) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
etyftqsrnlqefkprsqmeidflelamdefieryklegyafehivygdfshsqlgglhl
liglakrfkespfeledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsvvskvvkvtidyteisfmlwckdghvetfypkl

SCOPe Domain Coordinates for d7me0b2:

Click to download the PDB-style file with coordinates for d7me0b2.
(The format of our PDB-style files is described here.)

Timeline for d7me0b2: