SCOPe 2.07: Domain d7mbka_: 7mbk A:

Lineage for d7mbka_ (7mbk A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (5 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.0: automated matches [191532] (1 protein)
   not a true family

6. Protein automated matches [190901] (2 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [396003] (4 PDB entries)

8. Domain d7mbka_: 7mbk A: [403677]
   automated match to d4ddja_
   mutant

Details for d7mbka_

PDB Entry: 7mbk, 2.17 Å

PDB Description: n-terminal domain of mouse surfactant protein b, 6w mutant

PDB Compounds: (A:) Pulmonary surfactant-associated protein B

SCOPe Domain Sequences for d7mbka_:

Sequence; same for both SEQRES and ATOM records:

>d7mbka_ a.64.1.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
dlcqecedivhlltkmtkedafqeairkfweqecdilpwkllwprcrqvldvylplwidy
fqsqinpkawcnhwglc

Timeline for d7mbka_:

• d7mbka_ is new in SCOPe 2.07-stable
  
• d7mbka_ appears in the current release, SCOPe 2.08