Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) automatically mapped to Pfam PF09408 |
Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins) part of PfamB PB000266 |
Protein Spike protein S1 [143589] (5 species) |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (118 PDB entries) |
Domain d7mmoc_: 7mmo C: [403656] Other proteins in same PDB: d7mmoa1, d7mmoa2, d7mmob1, d7mmob2, d7mmod1, d7mmod2, d7mmoe1, d7mmoe2 automated match to d2dd8s1 complexed with nag |
PDB Entry: 7mmo (more details), 2.43 Å
SCOPe Domain Sequences for d7mmoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7mmoc_ d.318.1.1 (C:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} nlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcft nvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvggnynyly rlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvl sfellhapatvcgp
Timeline for d7mmoc_: