Lineage for d7lxzj_ (7lxz J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756295Domain d7lxzj_: 7lxz J: [403653]
    Other proteins in same PDB: d7lxzg_, d7lxzh_, d7lxzn_
    automated match to d4y5ve_
    complexed with bma, fuc, nag

Details for d7lxzj_

PDB Entry: 7lxz (more details), 2.6 Å

PDB Description: sars-cov-2 s/s2m11/s2l28 global refinement
PDB Compounds: (J:) S2L28 Fab Light Chain variable region

SCOPe Domain Sequences for d7lxzj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lxzj_ b.1.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiydvsdrpsgvsnr
fsgsksgntasltisglqaedeadyycssytssstpnwvfgggtklt

SCOPe Domain Coordinates for d7lxzj_:

Click to download the PDB-style file with coordinates for d7lxzj_.
(The format of our PDB-style files is described here.)

Timeline for d7lxzj_: