Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) automatically mapped to Pfam PF09408 |
Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein) part of PfamB PB000266 |
Protein Spike protein S1 [143589] (4 species) |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (92 PDB entries) |
Domain d7m6dc_: 7m6d C: [403651] Other proteins in same PDB: d7m6db1, d7m6db2, d7m6dl1, d7m6dl2 automated match to d2dd8s1 |
PDB Entry: 7m6d (more details), 3.1 Å
SCOPe Domain Sequences for d7m6dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7m6dc_ d.318.1.1 (C:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} tnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcf tnvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvggnynyl yrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvv lsfellhapatvcgpk
Timeline for d7m6dc_:
View in 3D Domains from other chains: (mouse over for more information) d7m6db1, d7m6db2, d7m6dl1, d7m6dl2 |