Lineage for d7mbla3 (7mbl A:388-583)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343304Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2343305Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2343749Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2343750Protein automated matches [254493] (6 species)
    not a true protein
  7. 2343804Species Horse (Equus caballus) [TaxId:9796] [256129] (26 PDB entries)
  8. 2343846Domain d7mbla3: 7mbl A:388-583 [403629]
    automated match to d1hk2a3
    complexed with co, so4

Details for d7mbla3

PDB Entry: 7mbl (more details), 2.7 Å

PDB Description: crystal structure of equine serum albumin in complex with cobalt (ii)
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d7mbla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mbla3 a.126.1.0 (A:388-583) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgkvgsrccklpeserlpc
senhlalalnrlcvlhektpvsekitkcctdslaerrpcfsaleldegyvpkefkaetft
fhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfsafvakccgaedkeacf
aeegpklvassqlala

SCOPe Domain Coordinates for d7mbla3:

Click to download the PDB-style file with coordinates for d7mbla3.
(The format of our PDB-style files is described here.)

Timeline for d7mbla3: