SCOPe 2.08: Domain d7lxxl_: 7lxx L:

Lineage for d7lxxl_ (7lxx L:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7lxxl_: 7lxx L: [403603]
   Other proteins in same PDB: d7lxxh_
   automated match to d4y5ve_
   complexed with fuc, nag

Details for d7lxxl_

PDB Entry: 7lxx, 3 Å

PDB Description: sars-cov-2 s/s2m11/s2l28 local refinement

PDB Compounds: (L:) S2L28 Fab Light Chain variable region

SCOPe Domain Sequences for d7lxxl_:

Sequence; same for both SEQRES and ATOM records:

>d7lxxl_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtqpasvsgspgqsitisctgtssdvggynyvswyqqhpgkapklmiydvsdrpsgvsnr
fsgsksgntasltisglqaedeadyycssytssstpnwvfgggtklt

Timeline for d7lxxl_:

• d7lxxl_ first appeared in SCOPe 2.07