Lineage for d7ly2n_ (7ly2 N:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355423Domain d7ly2n_: 7ly2 N: [403601]
    Other proteins in same PDB: d7ly2c_, d7ly2d_, d7ly2e_, d7ly2f_, d7ly2i_, d7ly2k_, d7ly2l_, d7ly2m_, d7ly2o_
    automated match to d5gs1b_
    complexed with bma, fuc, nag

Details for d7ly2n_

PDB Entry: 7ly2 (more details), 2.5 Å

PDB Description: sars-cov-2 s/s2m11/s2m28 global refinement
PDB Compounds: (N:) S2M28 Fab Heavy Chain variable region

SCOPe Domain Sequences for d7ly2n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ly2n_ b.1.1.1 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesgggvvqpgrslrlscaasgftfssygmhwvrqapgkglewvtviwydgsnryya
dsvkgrftisrdnskntlylqmdslraedtavyycaravagewyfdywgqgtlvtvs

SCOPe Domain Coordinates for d7ly2n_:

Click to download the PDB-style file with coordinates for d7ly2n_.
(The format of our PDB-style files is described here.)

Timeline for d7ly2n_: