Lineage for d7lnra_ (7lnr A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2619975Species Clostridioides difficile [TaxId:1496] [372824] (8 PDB entries)
  8. 2619983Domain d7lnra_: 7lnr A: [403590]
    automated match to d3isga_
    complexed with mpd, nxl, so4

Details for d7lnra_

PDB Entry: 7lnr (more details)

PDB Description: structure of the avibactam-cdd-1 120 minute complex in imidazole and mpd
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d7lnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lnra_ e.3.1.0 (A:) automated matches {Clostridioides difficile [TaxId: 1496]}
vnivdysdcfegisggaifcntknkeyniynkelietrrspcstfkivstliglekgvin
skesvmgydgtdypnknwnknlsleeafkescvwyykklinkvdaksvqnilddlkygnc
disewegdlkngkghlngfwlesslqispkeqvqtmakifegdtnfkkehinilrdimai
dvndaninvygktgtgfdeknkrvdawfvgmleregdtyyfaiksddsnkeitgpkvkei
ainiikkyys

SCOPe Domain Coordinates for d7lnra_:

Click to download the PDB-style file with coordinates for d7lnra_.
(The format of our PDB-style files is described here.)

Timeline for d7lnra_: