Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Clostridioides difficile [TaxId:1496] [372824] (8 PDB entries) |
Domain d7lnra_: 7lnr A: [403590] automated match to d3isga_ complexed with mpd, nxl, so4 |
PDB Entry: 7lnr (more details)
SCOPe Domain Sequences for d7lnra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lnra_ e.3.1.0 (A:) automated matches {Clostridioides difficile [TaxId: 1496]} vnivdysdcfegisggaifcntknkeyniynkelietrrspcstfkivstliglekgvin skesvmgydgtdypnknwnknlsleeafkescvwyykklinkvdaksvqnilddlkygnc disewegdlkngkghlngfwlesslqispkeqvqtmakifegdtnfkkehinilrdimai dvndaninvygktgtgfdeknkrvdawfvgmleregdtyyfaiksddsnkeitgpkvkei ainiikkyys
Timeline for d7lnra_: