Class g: Small proteins [56992] (98 folds) |
Fold g.86: Coronavirus NSP10-like [144245] (1 superfamily) binds two zinc ion per subunit; forms a dodecameric shell |
Superfamily g.86.1: Coronavirus NSP10-like [144246] (1 family) automatically mapped to Pfam PF09401 |
Family g.86.1.1: Coronavirus NSP10-like [144247] (2 proteins) partly covered by PfamB PB001266 |
Protein automated matches [191249] (4 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382496] (24 PDB entries) |
Domain d7lw3b_: 7lw3 B: [403585] automated match to d2xyqb_ complexed with edo, mes, mg, sah, yg4, zn |
PDB Entry: 7lw3 (more details), 2.3 Å
SCOPe Domain Sequences for d7lw3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lw3b_ g.86.1.1 (B:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} afavdaakaykdylasggqpitncvkmlcthtgtgqaitvtpeanmdqesfggascclyc rchidhpnpkgfcdlkgkyvqipttcandpvgftlrntvctvcgmwkgygcscdq
Timeline for d7lw3b_: