Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries) |
Domain d7m0ua_: 7m0u A: [403581] Other proteins in same PDB: d7m0ub_ automated match to d4e26a_ complexed with anp, mg, qo7 |
PDB Entry: 7m0u (more details), 3.09 Å
SCOPe Domain Sequences for d7m0ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7m0ua_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dweipdgqitvgqrigsgsfgtvykgkwhgdvavkmlnvtaptpqqlqafknevgvlrkt rhvnillfmgystkpqlaivtqwcegsslyhhlhiietkfemiklidiarqtaqgmdylh aksiihrdlksnniflhedltvkigdfglatvksrwsgshqfeqlsgsilwmapevirmq dknpysfqsdvyafgivlyelmtgqlpysninnrdqiifmvgrgylspdlskvrsncpka mkrlmaeclkkkrderplfpqilasiellarslp
Timeline for d7m0ua_: