Lineage for d7m3pb2 (7m3p B:118-174)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644721Superfamily h.1.11: XRCC4, C-terminal oligomerization domain [58022] (2 families) (S)
  5. 2644734Family h.1.11.0: automated matches [403565] (1 protein)
    not a true family
  6. 2644735Protein automated matches [403566] (1 species)
    not a true protein
  7. 2644736Species Saccharomyces cerevisiae [TaxId:4932] [403567] (1 PDB entry)
  8. 2644738Domain d7m3pb2: 7m3p B:118-174 [403574]
    Other proteins in same PDB: d7m3pa1, d7m3pa3, d7m3pb1
    automated match to d1fu1a2

Details for d7m3pb2

PDB Entry: 7m3p (more details), 2 Å

PDB Description: xrcc4-spc110p(164-207) fusion
PDB Compounds: (B:) Xrcc4-Spc110p(164-207)

SCOPe Domain Sequences for d7m3pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m3pb2 h.1.11.0 (B:118-174) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
npaevirelicycldeikslkheikelrkekndtlnnydtleeetddlknrlqalek

SCOPe Domain Coordinates for d7m3pb2:

Click to download the PDB-style file with coordinates for d7m3pb2.
(The format of our PDB-style files is described here.)

Timeline for d7m3pb2:

2644738
d7m3pb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d7m3pb1