SCOPe 2.07: Domain d7m3qb_: 7m3q B:

Lineage for d7m3qb_ (7m3q B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)

8. Domain d7m3qb_: 7m3q B: [403557]
   Other proteins in same PDB: d7m3qa_
   automated match to d4piga_
   complexed with cl, dtt, edo, na, so4

Details for d7m3qb_

PDB Entry: 7m3q, 2.5 Å

PDB Description: structure of the smurf2 hect domain with a high affinity ubiquitin variant (ubv)

PDB Compounds: (B:) Ubiquitin variant

SCOPe Domain Sequences for d7m3qb_:

Sequence, based on SEQRES records:

>d7m3qb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlifvwtfkgntitlevepsdtienvkakiqdkegippdqqrlifarkqledgrtlsdyn
ilkestlllvrrlr

Sequence, based on observed residues (ATOM records):

>d7m3qb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlifvwtfkgntitlevepsdtienvkakiqdkegippdqqrlifarkqledrtlsdyni
lkestlllvrrlr

Timeline for d7m3qb_:

• d7m3qb_ is new in SCOPe 2.07-stable
  
• d7m3qb_ appears in the current release, SCOPe 2.08