Lineage for d7m6dl2 (7m6d L:107-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362992Domain d7m6dl2: 7m6d L:107-214 [403551]
    Other proteins in same PDB: d7m6db1, d7m6db2, d7m6dc_, d7m6dl1
    automated match to d1dn0a2

Details for d7m6dl2

PDB Entry: 7m6d (more details), 3.1 Å

PDB Description: structure of the sars-cov-2 rbd in complex with neutralizing antibodies bg4-25 and cr3022
PDB Compounds: (L:) BG4-25 Fab Light Chain

SCOPe Domain Sequences for d7m6dl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m6dl2 b.1.1.2 (L:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d7m6dl2:

Click to download the PDB-style file with coordinates for d7m6dl2.
(The format of our PDB-style files is described here.)

Timeline for d7m6dl2: