SCOPe 2.08: Domain d7lvqk1: 7lvq K:391-743

Lineage for d7lvqk1 (7lvq K:391-743)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186847] (24 PDB entries)

8. Domain d7lvqk1: 7lvq K:391-743 [403548]
   Other proteins in same PDB: d7lvqa1, d7lvqa2, d7lvqb1, d7lvqb2, d7lvqk2
   automated match to d3gbja_
   complexed with anp, gdp, gtp, mg, ta1

Details for d7lvqk1

PDB Entry: 7lvq, 2.9 Å

PDB Description: kif14[391-743] - amp-pnp closed state class in complex with a microtubule

PDB Compounds: (K:) Kinesin-like protein KIF14

SCOPe Domain Sequences for d7lvqk1:

Sequence; same for both SEQRES and ATOM records:

>d7lvqk1 c.37.1.0 (K:391-743) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nsqvtvavrvrpfskrektekasqvvftngeeitvehpdmkqvysfiydvsfwsfdechp
gyasqttvyetlaaplldrafegyntclfaygqtgsgksytmmglneepgiiprfcedlf
aqiakkqtsevsyhlemsffevynekihdllvckgengqrkqplrarehpvsgpyvegls
mnvvssysdiqswlelgnkqrataatgmndkssrshsvftlvmtqtktevvegeehdhri
tsrinlvdlagsercstahssgqrlkegvsinkslltlgkvisalseqangkrvfipyre
stltwllkeslggnsktamiatvspaasnieetlstlryatqarlivniakvn

Timeline for d7lvqk1:

• d7lvqk1 first appeared in SCOPe 2.07