Lineage for d7ls5h_ (7ls5 H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2599866Domain d7ls5h_: 7ls5 H: [403542]
    Other proteins in same PDB: d7ls51_, d7ls52_, d7ls5a_, d7ls5b_, d7ls5c_, d7ls5d1, d7ls5d2, d7ls5e_, d7ls5f_, d7ls5g_, d7ls5i_, d7ls5j_, d7ls5m_, d7ls5n_, d7ls5o_, d7ls5p_, d7ls5q_, d7ls5r_, d7ls5s_, d7ls5t_, d7ls5u_, d7ls5w_, d7ls5x_
    automated match to d5fgin_

Details for d7ls5h_

PDB Entry: 7ls5 (more details), 2.74 Å

PDB Description: cryo-em structure of the pre3-1 20s proteasome core particle
PDB Compounds: (H:) Proteasome subunit beta type-1

SCOPe Domain Sequences for d7ls5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ls5h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tsimavtfkdgvildadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d7ls5h_:

Click to download the PDB-style file with coordinates for d7ls5h_.
(The format of our PDB-style files is described here.)

Timeline for d7ls5h_: