SCOPe 2.07: Domain d7lwcb_: 7lwc B:

Lineage for d7lwcb_ (7lwc B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (4 species)

7. Species Goat (Capra hircus) [TaxId:9925] [267757] (3 PDB entries)

8. Domain d7lwcb_: 7lwc B: [403536]
   automated match to d4tlja_
   mutant

Details for d7lwcb_

PDB Entry: 7lwc, 3 Å

PDB Description: goat beta-lactoglobulin mutant q59a

PDB Compounds: (B:) beta-lactoglobulin

SCOPe Domain Sequences for d7lwcb_:

Sequence; same for both SEQRES and ATOM records:

>d7lwcb_ b.60.1.1 (B:) beta-Lactoglobulin {Goat (Capra hircus) [TaxId: 9925]}
qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegnleillakweng
ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclvr
tpevdkealekfdkalkalpmhirlafnptqlegqch

Timeline for d7lwcb_:

• d7lwcb_ is new in SCOPe 2.07-stable
  
• d7lwcb_ appears in the current release, SCOPe 2.08